Pig Secondary Antibodies
American Research Products Inc Anti SARS CoV 2 RBD Beta27 Fab
Anti-SARS-CoV-2 RBD (Beta-27 Fab) Research Grade
Kingfisher Biotech Inc Swine IL-15 Recombinant Protein
The Swine IL-15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-15 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-15 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-15 Specifications: (Molecular Weight: 13.1 kDa) (Amino Acid Sequence: TWQHVISDLK KIEDLIRSIH MDATLYTESD AHPNCKVTAM KCFLLELRVI LQESRNSDIS DTVENLIILA NSSLSSIEYK TESGCKECEE LEEKNINEFL KSFIHIVQMF INPS) (Gene ID: 397683). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CXCL10 Recombinant Protein
The Swine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL10 Specifications: (Molecular Weight: 9.3 kda) (Amino Acid Sequence: PLSRTVRCTC IKISDRPVNP RSLEKLEMIP ASQSCPHVEI IATMKKNGEK RCLNPESKTI KNLLKAISKE RSKRSPRTQR EA (82)) (Gene ID: 494019). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CXCL13 Recombinant Protein
The Swine CXCL13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL13 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CXCL13 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL13 Specifications: (Molecular Weight: 10.0 kDa) (Amino Acid Sequence: VLETNDTNLK CQCLRSTSNW VPIRLIEKIQ IWPPGNGCPT REVIVWMTNK TAICLNPQSK LLQKLINLMW RKKTSTTLPA PVSKKSIA (88)) (Gene ID: 100524265). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CCL3L1 Recombinant Protein
The Swine CCL3L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL3L1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459). For research use only. Made in the USA
Innovative Research Inc US Pig Srm 500ml
Innovative Grade US Origin Porcine Serum 500ml - Innovative Grade US Origin Porcine Serum from Innovative Research is manufactured using whole blood collections from pigs. The animals used for this material are of US Origin, ensuring that only the highest-quality material is used for the production of the serum.
Kingfisher Biotech Inc Swine BAFF (TNFSF13B) Recombinant Protein
The Swine BAFF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine BAFF applications are for cell culture, ELISA standard, and Western Blot Control. The Swine BAFF yeast-derived recombinant protein can be purchased in multiple sizes. Swine BAFF Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: AAQDAEETVT QDCLQLIADS DMPTIRKGAY TFVPWLLSFK RGRALEEKEN KIVVKETGYF FIYGQVLYTD NTFAMGHLIQ RKKVHVFGDE LSLVTLFRCI QNMPETLPNN SCYSAGIAKL EEGDELQLAI PREDAKISRD GDGTFFGALK LL (152)) (Gene ID: 100038026). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CCL5 Recombinant Protein
The Swine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS) (Gene ID: 396613). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CXCL9 Recombinant Protein
The Swine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL9 Specifications: (Molecular Weight: 12.1 kDa) (Amino Acid Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)) (Gene ID: 100135681). For research use only. Made in the USA
Kingfisher Biotech Inc Swine IL-1 Receptor Antagonist Recombinant Protein
The Swine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: HPLGKRPCRM QAFRIWDVNQ KTFYLRNNQL VAGYLQGPNT KLEEKIDVVP VEPHFVFLGI HGGKLCLSCV KSGDEMKLQL EPVNITDLRK NSEQDKRFTF IRSDSGPTTS FESAACPGWF LCTALEADQP VGLTNTPKAA VKVTKFYFQQ DQ (152)) (Gene ID: 397499). For research use only. Made in the USA
Kingfisher Biotech Inc Swine IFN-beta Recombinant Protein
The Swine IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN beta Specifications: (Molecular Weight: 19.5 kDa) (Amino Acid Sequence: SYDVLRYQQR SSNLACQKLL GQLPGTPQYC LEDRMNFEVP EEIMQPPQFQ KEDAVLIIHE MLQQIFGILR RNFSSTGWNE TVIKTILVEL DGQMDDLETI LEEIMEEENF PRGDMTILHL KKYYLSILQY LKSKEYRSCA WTVVQVEILR NFSFLNRLTD YLRN) (Gene ID: 445459). For research use only. Made in the USA
Kingfisher Biotech Inc Swine CCL3L1 Recombinant Protein
The Swine CCL3L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL3L1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL3L1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL3L1 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APLGADTPTACCFSYTSRQLPRKFVADYFETSSQCSKPGVIFQTKKGREVCANPEDAWVQEYISDLELNA) (Gene ID: 494459). For research use only. Made in the USA